General Information

  • ID:  hor002054
  • Uniprot ID:  P07490
  • Protein name:  Prolactin release-inhibiting factor 1
  • Gene name:  GNRH1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Central nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
  • GO BP:  GO:0000003 reproduction; GO:0007165 signal transduction; GO:0007565 female pregnancy; GO:0010468 regulation of gene expression; GO:0014070 response to organic cyclic compound; GO:0030238 male sex determination; GO:0032496 response to lipopolysaccharide; GO:0033087 negative regulation of immature T cell proliferation; GO:0033574 response to testosterone; GO:0034695 response to prostaglandin E; GO:0035864 response to potassium ion; GO:0045471 response to ethanol; GO:0048545 response to steroid hormone; GO:2000354 regulation of ovarian follicle development; GO:2001223 negative regulation of neuron migration
  • GO CC:  NA

Sequence Information

  • Sequence:  NTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
  • Length:  56(37-92)
  • Propeptide:  METIPKLMAAVVLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
  • Signal peptide:  METIPKLMAAVVLLTVCLEGCSS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Gnrhr
  • Target Unid:  P30969
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07490-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002054_AF2.pdbhor002054_ESM.pdb

Physical Information

Mass: 756654 Formula: C281H442N82O93S4
Absent amino acids: Y Common amino acids: E
pI: 4.43 Basic residues: 9
Polar residues: 10 Hydrophobic residues: 14
Hydrophobicity: -109.64 Boman Index: -16482
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 57.5
Instability Index: 8539.29 Extinction Coefficient cystines: 5500
Absorbance 280nm: 100

Literature

  • PubMed ID:  NA
  • Title:  NA